SCOPe 2.08: Domain d1opda_: 1opd A:

Lineage for d1opda_ (1opd A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (3 proteins)
   automatically mapped to Pfam PF00381

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)

7. Species Escherichia coli [TaxId:562] [55599] (23 PDB entries)

8. Domain d1opda_: 1opd A: [40560]
   complexed with so4; mutant

Details for d1opda_

PDB Entry: 1opd, 1.5 Å

PDB Description: histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d)

PDB Compounds: (A:) histidine-containing protein

SCOPe Domain Sequences for d1opda_:

Sequence; same for both SEQRES and ATOM records:

>d1opda_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli [TaxId: 562]}
mfeqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakdlfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

Timeline for d1opda_:

• d1opda_ first appeared (with stable ids) in SCOP 1.55, called d1opd__
  
• d1opda_ appears in SCOPe 2.07