Lineage for d3ezab_ (3eza B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195073Fold d.94: HPr-like [55593] (2 superfamilies)
  4. 195074Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 195075Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 195079Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species)
  7. 195097Species Escherichia coli [TaxId:562] [55599] (11 PDB entries)
  8. 195105Domain d3ezab_: 3eza B: [40555]
    Other proteins in same PDB: d3ezaa1, d3ezaa2

Details for d3ezab_

PDB Entry: 3eza (more details)

PDB Description: complex of the amino terminal domain of enzyme i and the histidine- containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d3ezab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ezab_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Escherichia coli}
mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
vtisaegedeqkavehlvklmaele

SCOP Domain Coordinates for d3ezab_:

Click to download the PDB-style file with coordinates for d3ezab_.
(The format of our PDB-style files is described here.)

Timeline for d3ezab_: