Lineage for d2hpr__ (2hpr -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.94: HPr-like [55593] (1 superfamily) Superfamily d.94.1: HPr-like [55594] (1 family) 
Family d.94.1.1: HPr-like [55595] (2 proteins) Protein Histidine-containing phosphocarrier protein (HPr) [55596] (6 species) 
Species Bacillus subtilis [TaxId:1423] [55597] (4 PDB entries) 
Domain d2hpr__: 2hpr - [40546]
Details for d2hpr__
PDB Entry: 2hpr (more details), 2 Å
PDB Description: histidine-containing phosphocarrier protein hpr mutant with met 51 replaced by val and ser 83 replaced by cys (m51v, s83c)
SCOP Domain Sequences for d2hpr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hpr__ d.94.1.1 (-) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis}
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvvslgiakgaei
tisasgadendalnaleetmkceglge
SCOP Domain Coordinates for d2hpr__:
Click to download the PDB-style file with coordinates for d2hpr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hpr__:
- d2hpr__ first appeared (with stable ids) in SCOP 1.55
- d2hpr__ appears in SCOP 1.57
- d2hpr__ appears in SCOP 1.61
- d2hpr__ appears in the current release, SCOPe 2.08, called d2hpra_
View in 3D