SCOPe 2.01: Domain d1sphb_: 1sph B:

Lineage for d1sphb_ (1sph B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.94: HPr-like [55593] (2 superfamilies)
   beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423

4. Superfamily d.94.1: HPr-like [55594] (2 families)

5. Family d.94.1.1: HPr-like [55595] (2 proteins)

6. Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)

7. Species Bacillus subtilis [TaxId:1423] [55597] (7 PDB entries)

8. Domain d1sphb_: 1sph B: [40545]

Details for d1sphb_

PDB Entry: 1sph, 2 Å

PDB Description: refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition

PDB Compounds: (B:) histidine-containing phosphocarrier protein hpr

SCOPe Domain Sequences for d1sphb_:

Sequence; same for both SEQRES and ATOM records:

>d1sphb_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis [TaxId: 1423]}
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgaei
tisasgadendalnaleetmkseglge

Timeline for d1sphb_:

• d1sphb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sphb_ appears in SCOP 1.75
  
• d1sphb_ appears in SCOPe 2.02
  
• d1sphb_ appears in the current release, SCOPe 2.08