Lineage for d1sphb_ (1sph B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035733Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1035734Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1035735Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 1035752Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)
  7. 1035761Species Bacillus subtilis [TaxId:1423] [55597] (7 PDB entries)
  8. 1035763Domain d1sphb_: 1sph B: [40545]

Details for d1sphb_

PDB Entry: 1sph (more details), 2 Å

PDB Description: refined structures of the active s83c and impaired s46d hprs: evidence that phosphorylation does not require a backbone conformational transition
PDB Compounds: (B:) histidine-containing phosphocarrier protein hpr

SCOPe Domain Sequences for d1sphb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sphb_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Bacillus subtilis [TaxId: 1423]}
aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlkdimgvmslgiakgaei
tisasgadendalnaleetmkseglge

SCOPe Domain Coordinates for d1sphb_:

Click to download the PDB-style file with coordinates for d1sphb_.
(The format of our PDB-style files is described here.)

Timeline for d1sphb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1spha_