Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378) |
Family b.69.13.0: automated matches [227242] (1 protein) not a true family |
Protein automated matches [227008] (11 species) not a true protein |
Species Xanthomonas campestris [TaxId:190485] [405380] (1 PDB entry) |
Domain d7kn8a1: 7kn8 A:45-430 [405381] automated match to d5fkqa1 complexed with bgc, edo, iod, na, xys |
PDB Entry: 7kn8 (more details), 1.95 Å
SCOPe Domain Sequences for d7kn8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kn8a1 b.69.13.0 (A:45-430) automated matches {Xanthomonas campestris [TaxId: 190485]} pyqwrsvaiggggfvtgvlfhpaerglayartdvggayrwdaqaqqwtaltdwlgaddwn lmgidafavdpadadalylaagtymheragnaavlrsfnrgrtferadlpfklggnqlgr angerlavdphdgrvlllgsrdaglwrsddrgahwakvasfpdaalagatarnhvgreqa vgiafvvfdaasgntgtptpriyvgvsteqtslyvsedagrswapvagqprglrpshmag gsdghwylsygdqpgpdlmaggalwkftpaqgrwreispipqpasgdgfgwgavavdpqq pqvllastfrrrtprdelyrsvdggkhwaplladavfdhsaapwtahatphwmgalaidp fdgnhalfvtgygiwasrnlqdfaap
Timeline for d7kn8a1: