SCOPe 2.08: Domain d7kn8a1: 7kn8 A:45-430

Lineage for d7kn8a1 (7kn8 A:45-430)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families)
   duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)

5. Family b.69.13.0: automated matches [227242] (1 protein)
   not a true family

6. Protein automated matches [227008] (11 species)
   not a true protein

7. Species Xanthomonas campestris [TaxId:190485] [405380] (1 PDB entry)

8. Domain d7kn8a1: 7kn8 A:45-430 [405381]
   automated match to d5fkqa1
   complexed with bgc, edo, iod, na, xys

Details for d7kn8a1

PDB Entry: 7kn8, 1.95 Å

PDB Description: crystal structure of the gh74 xyloglucanase from xanthomonas campestris (xcc1752)

PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d7kn8a1:

Sequence; same for both SEQRES and ATOM records:

>d7kn8a1 b.69.13.0 (A:45-430) automated matches {Xanthomonas campestris [TaxId: 190485]}
pyqwrsvaiggggfvtgvlfhpaerglayartdvggayrwdaqaqqwtaltdwlgaddwn
lmgidafavdpadadalylaagtymheragnaavlrsfnrgrtferadlpfklggnqlgr
angerlavdphdgrvlllgsrdaglwrsddrgahwakvasfpdaalagatarnhvgreqa
vgiafvvfdaasgntgtptpriyvgvsteqtslyvsedagrswapvagqprglrpshmag
gsdghwylsygdqpgpdlmaggalwkftpaqgrwreispipqpasgdgfgwgavavdpqq
pqvllastfrrrtprdelyrsvdggkhwaplladavfdhsaapwtahatphwmgalaidp
fdgnhalfvtgygiwasrnlqdfaap

Timeline for d7kn8a1:

• d7kn8a1 first appeared in SCOPe 2.07