Lineage for d1a81g2 (1a81 G:152-262)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194873Fold d.93: SH2-like [55549] (1 superfamily)
  4. 194874Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 194875Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 195027Protein Syk tyrosine kinase [55575] (1 species)
  7. 195028Species Human (Homo sapiens) [TaxId:9606] [55576] (3 PDB entries)
  8. 195036Domain d1a81g2: 1a81 G:152-262 [40514]

Details for d1a81g2

PDB Entry: 1a81 (more details), 3 Å

PDB Description: crystal structure of the tandem sh2 domain of the syk kinase bound to a dually tyrosine-phosphorylated itam

SCOP Domain Sequences for d1a81g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a81g2 d.93.1.1 (G:152-262) Syk tyrosine kinase {Human (Homo sapiens)}
pqlekliattahekmpwfhgkisreeseqivligsktngkflirardnngsyalcllheg
kvlhyridkdktgklsipegkkfdtlwqlvehysykadgllrvltvpcqki

SCOP Domain Coordinates for d1a81g2:

Click to download the PDB-style file with coordinates for d1a81g2.
(The format of our PDB-style files is described here.)

Timeline for d1a81g2: