Lineage for d7dxha_ (7dxh a:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027631Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (27 PDB entries)
  8. 3027680Domain d7dxha_: 7dxh a: [405128]
    Other proteins in same PDB: d7dxhb_, d7dxhc_, d7dxhe_, d7dxhf_, d7dxhh_, d7dxhi_, d7dxhk_, d7dxhl_, d7dxhm_, d7dxht_, d7dxhx_, d7dxhz_
    automated match to d2axta1
    complexed with bcr, cl, cla, dgd, fe2, hem, htg, lmt, mge, pho, pq9, sqd, unl

Details for d7dxha_

PDB Entry: 7dxh (more details), 3.14 Å

PDB Description: cryo-em structure of psii intermediate psb28-psii complex
PDB Compounds: (a:) Photosystem II protein D1

SCOPe Domain Sequences for d7dxha_:

Sequence, based on SEQRES records: (download)

>d7dxha_ f.26.1.1 (a:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
nlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgsl
lygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrqw
elsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaehn
ilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetynivaa
hgyfgrlifqyasfnnsrslhfflaawrvvgvwfaalgistmafnlngfnfnhsvidakg
nvintwadiinranlgmevmhe

Sequence, based on observed residues (ATOM records): (download)

>d7dxha_ f.26.1.1 (a:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
nlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsgsl
lygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgrqw
elsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqaehn
ilmhpfhqlgvagvfggalfcamhgslvtsslirettetnivaahgyfgrlsrslhffla
awrvvgvwfaalgistmafnlngfnfnhsvidakgnvintwadiinranlgmevmhe

SCOPe Domain Coordinates for d7dxha_:

Click to download the PDB-style file with coordinates for d7dxha_.
(The format of our PDB-style files is described here.)

Timeline for d7dxha_: