Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) automatically mapped to Pfam PF02419 |
Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries) |
Domain d7dxal_: 7dxa l: [405114] Other proteins in same PDB: d7dxaa_, d7dxab_, d7dxad_, d7dxae_, d7dxaf_, d7dxah_, d7dxai_, d7dxam_, d7dxat_, d7dxax_ automated match to d5tisl_ complexed with bcr, cl, cla, dgd, fe2, hem, htg, lmt, mge, pho, pq9, sqd, unl |
PDB Entry: 7dxa (more details), 3.14 Å
SCOPe Domain Sequences for d7dxal_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dxal_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]} mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d7dxal_: