Lineage for d7dxal_ (7dxa l:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631727Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2631728Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 2631729Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 2631737Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)
  8. 2631765Domain d7dxal_: 7dxa l: [405114]
    Other proteins in same PDB: d7dxaa_, d7dxab_, d7dxad_, d7dxae_, d7dxaf_, d7dxah_, d7dxai_, d7dxam_, d7dxat_, d7dxax_
    automated match to d5tisl_
    complexed with bcr, cl, cla, dgd, fe2, hem, htg, lmt, mge, pho, pq9, sqd, unl

Details for d7dxal_

PDB Entry: 7dxa (more details), 3.14 Å

PDB Description: psii intermediate psb28-rc47
PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d7dxal_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dxal_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d7dxal_:

Click to download the PDB-style file with coordinates for d7dxal_.
(The format of our PDB-style files is described here.)

Timeline for d7dxal_: