SCOPe 2.07: Domain d7cslb1: 7csl B:5-215

Lineage for d7cslb1 (7csl B:5-215)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [268084] (2 PDB entries)

8. Domain d7cslb1: 7csl B:5-215 [404905]
   Other proteins in same PDB: d7csla2, d7csla3, d7cslb2, d7cslb3
   automated match to d3wyaa1

Details for d7cslb1

PDB Entry: 7csl, 2 Å

PDB Description: crystal structure of the archaeal ef1a-ef1b complex

PDB Compounds: (B:) Elongation factor 1-alpha

SCOPe Domain Sequences for d7cslb1:

Sequence, based on SEQRES records:

>d7cslb1 c.37.1.0 (B:5-215) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
kphvnivfighvdhgksttigrllydtgnipetiikkfeemgekgksfkfawvmdrlkee
rergitidvahtkfetphryitiidapghrdfvknmitgasqadaavlvvaatdgvmpqt
kehaflartlgikhiivtinkmdmvnydqkvfekvkaqvekllktlgykdfpviptsawn
gdnvvkksdkmpwyngptliealdqipepek

Sequence, based on observed residues (ATOM records):

>d7cslb1 c.37.1.0 (B:5-215) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
kphvnivfighvdhgksttigrllydtgnipetiikkfeemgekgksfkfawvmdrlkee
rergidvahtkfetphryitiidapghrdfvknmitgasqadaavlvvaatdgvmpqtke
haflartlgikhiivtinkmdmvnydqkvfekvkaqvekllktlgykdfpviptsawngd
nvvkksdkmpwyngptliealdqipepek

Timeline for d7cslb1:

• d7cslb1 is new in SCOPe 2.07-stable
  
• d7cslb1 appears in the current release, SCOPe 2.08