Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (25 proteins) |
Protein Hemopoetic cell kinase Hck [55565] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries) |
Domain d1qcfa2: 1qcf A:146-248 [40490] Other proteins in same PDB: d1qcfa1, d1qcfa3 complexed with pp1; mutant |
PDB Entry: 1qcf (more details), 2 Å
SCOP Domain Sequences for d1qcfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens)} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d1qcfa2: