Lineage for d1qcfa2 (1qcf A:146-248)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34525Fold d.93: SH2-like [55549] (1 superfamily)
  4. 34526Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 34527Family d.93.1.1: SH2 domain [55551] (19 proteins)
  6. 34590Protein Hemopoetic cell kinase Hck [55565] (1 species)
  7. 34591Species Human (Homo sapiens) [TaxId:9606] [55566] (4 PDB entries)
  8. 34592Domain d1qcfa2: 1qcf A:146-248 [40490]
    Other proteins in same PDB: d1qcfa1, d1qcfa3

Details for d1qcfa2

PDB Entry: 1qcf (more details), 2 Å

PDB Description: crystal structure of hck in complex with a src family-selective tyrosine kinase inhibitor
PDB Compounds: (A:)

SCOP Domain Sequences for d1qcfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens)}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOP Domain Coordinates for d1qcfa2:

Click to download the PDB-style file with coordinates for d1qcfa2.
(The format of our PDB-style files is described here.)

Timeline for d1qcfa2: