Lineage for d1ghu__ (1ghu -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.93: SH2-like [55549] (1 superfamily) Superfamily d.93.1: SH2 domain [55550] (1 family) 
Family d.93.1.1: SH2 domain [55551] (20 proteins) 
Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55564] (10 PDB entries) 
Domain d1ghu__: 1ghu - [40475]
Details for d1ghu__
PDB Entry: 1ghu (more details)
PDB Description: nmr solution structure of growth factor receptor-bound protein 2 (grb2) sh2 domain, 24 structures
SCOP Domain Sequences for d1ghu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghu__ d.93.1.1 (-) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens)}
gswffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
yflwvvkfnslnelvdyhrstsvsrnqqiflrdie
SCOP Domain Coordinates for d1ghu__:
Click to download the PDB-style file with coordinates for d1ghu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ghu__:
- d1ghu__ first appeared (with stable ids) in SCOP 1.55
- d1ghu__ appears in SCOP 1.57
- d1ghu__ appears in SCOP 1.61
- d1ghu__ appears in the current release, SCOPe 2.08, called d1ghua1
View in 3D