SCOPe 2.08: Domain d7cfxl_: 7cfx L:

Lineage for d7cfxl_ (7cfx L:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family)
   consists of single alpha-helix and irregular N-terminal tail
   automatically mapped to Pfam PF02315

5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)

6. Protein automated matches [190583] (3 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries)

8. Domain d7cfxl_: 7cfx L: [404650]
   Other proteins in same PDB: d7cfxa_, d7cfxb_, d7cfxc_, d7cfxd_, d7cfxg_, d7cfxh_, d7cfxm_, d7cfxn_
   automated match to d4tqom_
   complexed with ca, pqq

Details for d7cfxl_

PDB Entry: 7cfx, 2.5 Å

PDB Description: nad-soaked holo-methanol dehydrogenase (mdh) from methylococcus capsulatus (bath)

PDB Compounds: (L:) Methanol dehydrogenase [cytochrome c] subunit 2

SCOPe Domain Sequences for d7cfxl_:

Sequence; same for both SEQRES and ATOM records:

>d7cfxl_ a.137.2.1 (L:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedi

Timeline for d7cfxl_:

• d7cfxl_ first appeared in SCOPe 2.07