Lineage for d7cb2a1 (7cb2 A:1-175)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456930Species Staphylococcus aureus [TaxId:426430] [401772] (4 PDB entries)
  8. 2456931Domain d7cb2a1: 7cb2 A:1-175 [404590]
    Other proteins in same PDB: d7cb2a2, d7cb2b2, d7cb2c2, d7cb2d2
    automated match to d2w8za1
    complexed with cit, nap, no3

Details for d7cb2a1

PDB Entry: 7cb2 (more details), 2.15 Å

PDB Description: the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d7cb2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cb2a1 c.2.1.0 (A:1-175) automated matches {Staphylococcus aureus [TaxId: 426430]}
mtqqigviglavmgknlawniesrgysvsvfnrssektdlmveeskgknihptysleefv
nslekprkillmvqagkatdatidsllpllddgdilidggntnyqdtirrnkalaqsain
figmgvsggeigaltgpslmpggqeeaynkvadildaiaakakdgascvtyigpn

SCOPe Domain Coordinates for d7cb2a1:

Click to download the PDB-style file with coordinates for d7cb2a1.
(The format of our PDB-style files is described here.)

Timeline for d7cb2a1: