Lineage for d1aouf_ (1aou F:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82601Protein Tyrosine kinase Fyn [55559] (1 species)
  7. 82602Species Human (Homo sapiens) [TaxId:9606] [55560] (3 PDB entries)
  8. 82606Domain d1aouf_: 1aou F: [40459]

Details for d1aouf_

PDB Entry: 1aou (more details)

PDB Description: nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, 22 structures

SCOP Domain Sequences for d1aouf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aouf_ d.93.1.1 (F:) Tyrosine kinase Fyn {Human (Homo sapiens)}
siqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkh
ykirkldnggyyittraqfetlqqlvqhyseraaglssrlvvpshk

SCOP Domain Coordinates for d1aouf_:

Click to download the PDB-style file with coordinates for d1aouf_.
(The format of our PDB-style files is described here.)

Timeline for d1aouf_: