Lineage for d1aouf_ (1aou F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965635Protein Tyrosine kinase Fyn [55559] (1 species)
  7. 2965636Species Human (Homo sapiens) [TaxId:9606] [55560] (6 PDB entries)
  8. 2965645Domain d1aouf_: 1aou F: [40459]

Details for d1aouf_

PDB Entry: 1aou (more details)

PDB Description: nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, 22 structures
PDB Compounds: (F:) fyn protein-tyrosine kinase

SCOPe Domain Sequences for d1aouf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aouf_ d.93.1.1 (F:) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]}
siqaeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddmkgdhvkh
ykirkldnggyyittraqfetlqqlvqhyseraaglssrlvvpshk

SCOPe Domain Coordinates for d1aouf_:

Click to download the PDB-style file with coordinates for d1aouf_.
(The format of our PDB-style files is described here.)

Timeline for d1aouf_: