Lineage for d1a09a_ (1a09 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1212958Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1212959Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1212960Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1212977Protein c-src tyrosine kinase [55556] (3 species)
  7. 1212982Species Human (Homo sapiens) [TaxId:9606] [55557] (43 PDB entries)
  8. 1213011Domain d1a09a_: 1a09 A: [40438]

Details for d1a09a_

PDB Entry: 1a09 (more details), 2 Å

PDB Description: c-src (sh2 domain) complexed with ace-formyl phosphotyr-glu-(n,n- dipentyl amine)
PDB Compounds: (A:) c-src tyrosine kinase

SCOPe Domain Sequences for d1a09a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a09a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
dsiqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvk
hykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

SCOPe Domain Coordinates for d1a09a_:

Click to download the PDB-style file with coordinates for d1a09a_.
(The format of our PDB-style files is described here.)

Timeline for d1a09a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a09b_