Lineage for d6youa_ (6you A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980113Protein cAMP-dependent PK, catalytic subunit [56116] (7 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 2980116Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [346668] (33 PDB entries)
  8. 2980146Domain d6youa_: 6you A: [404244]
    automated match to d1smha_
    complexed with p4q

Details for d6youa_

PDB Entry: 6you (more details), 1.73 Å

PDB Description: crystal structure of the camp-dependent protein kinase a in complex with pyrido[3,2-d]pyrimidin-4-amine (soaked)
PDB Compounds: (A:) cAMP-dependent protein kinase catalytic subunit alpha

SCOPe Domain Sequences for d6youa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6youa_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
esvkeflakakeeflkkwespsqntaqldhfdriktlgtgsfgrvmlvkhketgnhyamk
ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshl
rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
grtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivs
gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
pfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

SCOPe Domain Coordinates for d6youa_:

Click to download the PDB-style file with coordinates for d6youa_.
(The format of our PDB-style files is described here.)

Timeline for d6youa_: