Lineage for d6yonc_ (6yon C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439898Protein automated matches [190057] (27 species)
    not a true protein
  7. 2440035Species Talaromyces verruculosus [TaxId:198730] [330334] (6 PDB entries)
  8. 2440053Domain d6yonc_: 6yon C: [404235]
    automated match to d5i6sa_
    complexed with nag, so4

Details for d6yonc_

PDB Entry: 6yon (more details), 2.6 Å

PDB Description: crystal structure of endoglucanase s127c/a165c from penicillium verruculosum
PDB Compounds: (C:) endoglucanase

SCOPe Domain Sequences for d6yonc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yonc_ c.1.8.3 (C:) automated matches {Talaromyces verruculosus [TaxId: 198730]}
assfewfgsnesgaefgsgnipgvegtdytfpnttaiqilidagmnifrvpflmermipt
emtgsldtayfegysevinyitgkgahavvdphnfgryygtpisstsdfqtfwstlacqf
ksndlvifdtnneyhdmdesvvvalnqaaidgirdcgattqyifvegnaysgawtwttyn
tamvnltdpsdlivyemhqyldsdgsgtsdqcvsstvgqervvdattwlqsngklgilge
faggansvceeavegmldylaensdvwlgaswwsagpwwqdyiysmeppngiayesylsi
letyf

SCOPe Domain Coordinates for d6yonc_:

Click to download the PDB-style file with coordinates for d6yonc_.
(The format of our PDB-style files is described here.)

Timeline for d6yonc_: