Lineage for d1lcka2 (1lck A:117-226)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194873Fold d.93: SH2-like [55549] (1 superfamily)
  4. 194874Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 194875Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 194982Protein p56-lck tyrosine kinase [55552] (1 species)
  7. 194983Species Human (Homo sapiens) [TaxId:9606] [55553] (10 PDB entries)
  8. 194994Domain d1lcka2: 1lck A:117-226 [40421]
    Other proteins in same PDB: d1lcka1

Details for d1lcka2

PDB Entry: 1lck (more details), 2.5 Å

PDB Description: sh3-sh2 domain fragment of human p56-lck tyrosine kinase complexed with the 10 residue synthetic phosphotyrosyl peptide tegqpyqpqpa

SCOP Domain Sequences for d1lcka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lcka2 d.93.1.1 (A:117-226) p56-lck tyrosine kinase {Human (Homo sapiens)}
akanslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqge
vvkhykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOP Domain Coordinates for d1lcka2:

Click to download the PDB-style file with coordinates for d1lcka2.
(The format of our PDB-style files is described here.)

Timeline for d1lcka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lcka1