Lineage for d6x27g_ (6x27 G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2538081Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2538082Protein automated matches [190826] (22 species)
    not a true protein
  7. 2538179Species Human (Homo sapiens) [TaxId:9606] [189350] (12 PDB entries)
  8. 2538194Domain d6x27g_: 6x27 G: [404208]
    automated match to d2x36c_
    complexed with 1pe, bo2, gol

Details for d6x27g_

PDB Entry: 6x27 (more details), 2.12 Å

PDB Description: lon protease proteolytic domain complexed with bortezomib
PDB Compounds: (G:) lon protease homolog, mitochondrial

SCOPe Domain Sequences for d6x27g_:

Sequence, based on SEQRES records: (download)

>d6x27g_ d.14.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmkesa
riaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvr
qnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevh
fvehyreifdiafp

Sequence, based on observed residues (ATOM records): (download)

>d6x27g_ d.14.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rmydvtppgvvmglawtamggstlfvetslrrdgslevtgqlgevmkesariaytfaraf
lmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamtgevs
ltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyreifd
iafp

SCOPe Domain Coordinates for d6x27g_:

Click to download the PDB-style file with coordinates for d6x27g_.
(The format of our PDB-style files is described here.)

Timeline for d6x27g_: