Lineage for d6wxic_ (6wxi C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022539Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 3022540Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. 3022541Family f.5.1.1: Outer membrane efflux proteins (OEP) [56955] (3 proteins)
    Pfam PF02321
  6. 3022557Protein automated matches [191223] (3 species)
    not a true protein
  7. 3022565Species Escherichia coli [TaxId:83333] [404029] (2 PDB entries)
  8. 3022571Domain d6wxic_: 6wxi C: [404168]
    automated match to d5bunc_

Details for d6wxic_

PDB Entry: 6wxi (more details), 2.84 Å

PDB Description: colicin e1 fragment in nanodisc-embedded tolc
PDB Compounds: (C:) outer membrane protein tolc

SCOPe Domain Sequences for d6wxic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wxic_ f.5.1.1 (C:) automated matches {Escherichia coli [TaxId: 83333]}
enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlanevtarnnldnave
qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
gysvgtrtivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
kpvstnpe

SCOPe Domain Coordinates for d6wxic_:

Click to download the PDB-style file with coordinates for d6wxic_.
(The format of our PDB-style files is described here.)

Timeline for d6wxic_: