SCOPe 2.07: Domain d6wysb1: 6wys B:754-949

Lineage for d6wysb1 (6wys B:754-949)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189350] (12 PDB entries)

8. Domain d6wysb1: 6wys B:754-949 [404113]
   Other proteins in same PDB: d6wysb2, d6wysc2
   automated match to d2x36c_
   complexed with so4

Details for d6wysb1

PDB Entry: 6wys, 2.23 Å

PDB Description: lon protease proteolytic domain

PDB Compounds: (B:) lon protease homolog, mitochondrial

SCOPe Domain Sequences for d6wysb1:

Sequence, based on SEQRES records:

>d6wysb1 d.14.1.0 (B:754-949) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ermydvtppgvvmglawtamggstlfvetslrrpqdkdakgdkdgslevtgqlgevmkes
ariaytfaraflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpv
rqnlamtgevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglev
hfvehyreifdiafpd

Sequence, based on observed residues (ATOM records):

>d6wysb1 d.14.1.0 (B:754-949) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ermydvtppgvvmglawtamggstlfvetslrrpqddgslevtgqlgevmkesariaytf
araflmqhapandylvtshihlhvpegatpkdgpsagctivtallslamgrpvrqnlamt
gevsltgkilpvggikektiaakragvtcivlpaenkkdfydlaafiteglevhfvehyr
eifdiafpd

Timeline for d6wysb1:

• d6wysb1 is new in SCOPe 2.07-stable
  
• d6wysb1 appears in the current release, SCOPe 2.08