Lineage for d6wpma_ (6wpm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916209Species Synechococcus sp. [TaxId:1131] [403976] (2 PDB entries)
  8. 2916212Domain d6wpma_: 6wpm A: [404090]
    automated match to d4qsda_
    complexed with edo, gol, so4, zn

Details for d6wpma_

PDB Entry: 6wpm (more details), 2.88 Å

PDB Description: crystal structure of a putative oligosaccharide periplasmic-binding protein from synechococcus sp. mits9220 in complex with zinc
PDB Compounds: (A:) Substrate-binding protein

SCOPe Domain Sequences for d6wpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wpma_ c.94.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 1131]}
tlqlwtlqlapkfnpymddvlgswdklhpealvrwtdlpwgsverkllaavfartapdvv
nlnppfaanlaskggltdltallppgaeqnylpsvweaardpeagqiaipwyltvrlslv
ngdllrqaglsraprrwdevpayarsirertgryglfvtvvpddsaellesfvqmgvsll
darqraafntpagrkafafwtdlyregllprevvsqgqrraielyqsgelallasgaefl
rsiqtnapgvaavttpqppltgsdgtanvalmtlavprqsqqageavelalfltngtnqa
rfarearvlpsslealsairaeleveqpsnpaeaqirdarllsaetlntarvlvpatpgv
krlqsiiytqlqramlgqissdqavleaeqqwnryasarwp

SCOPe Domain Coordinates for d6wpma_:

Click to download the PDB-style file with coordinates for d6wpma_.
(The format of our PDB-style files is described here.)

Timeline for d6wpma_: