Lineage for d6xhpb_ (6xhp B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899417Species Staphylococcus aureus [TaxId:1280] [404012] (5 PDB entries)
  8. 2899425Domain d6xhpb_: 6xhp B: [404080]
    automated match to d2vsha_
    complexed with pg4

Details for d6xhpb_

PDB Entry: 6xhp (more details), 1.9 Å

PDB Description: crystal structure of s. aureus tari (space group c121)
PDB Compounds: (B:) Ribitol-5-phosphate cytidylyltransferase 1

SCOPe Domain Sequences for d6xhpb_:

Sequence, based on SEQRES records: (download)

>d6xhpb_ c.68.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
kyagilaggigsrmgnvplpkqfldldnkpilihtlekfilindfekiiiatpqqwmtht
kdtlrkfkisderieviqggsdrndtimnivkhiestngindddvivthdavrpflthri
ikeniqaaleygavdtvidaidtivtskdnqtidaipvrnemyqgqtpqsfninllkesy
aqlsdeqksilsdackiivetnkpvrlvkgelynikvttpydlkvanaiir

Sequence, based on observed residues (ATOM records): (download)

>d6xhpb_ c.68.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
kyagilaglpkqfldldnkpilihtlekfilindfekiiiatpqqwmthtkdtlrkfkis
derieviqggsdrndtimnivkhiestngindddvivthdavrpflthriikeniqaale
ygavdtvidaidtivtskdnqtidaipvrnemyqgqtpqsfninllkesyaqlsdeqksi
lsdackiivetnkpvrlvkgelynikvttpydlkvanaiir

SCOPe Domain Coordinates for d6xhpb_:

Click to download the PDB-style file with coordinates for d6xhpb_.
(The format of our PDB-style files is described here.)

Timeline for d6xhpb_: