Lineage for d1mmpa_ (1mmp A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661136Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1661342Protein Matrilysin (MMP-7) [55538] (1 species)
  7. 1661343Species Human (Homo sapiens) [TaxId:9606] [55539] (3 PDB entries)
  8. 1661345Domain d1mmpa_: 1mmp A: [40397]
    complexed with ca, rss, zn

Details for d1mmpa_

PDB Entry: 1mmp (more details), 2.3 Å

PDB Description: matrilysin complexed with carboxylate inhibitor
PDB Compounds: (A:) gelatinase a

SCOPe Domain Sequences for d1mmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmpa_ d.92.1.11 (A:) Matrilysin (MMP-7) {Human (Homo sapiens) [TaxId: 9606]}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygk

SCOPe Domain Coordinates for d1mmpa_:

Click to download the PDB-style file with coordinates for d1mmpa_.
(The format of our PDB-style files is described here.)

Timeline for d1mmpa_: