Lineage for d1mmpa_ (1mmp A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135817Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins)
  6. 135853Protein Matrilysin (MMP-9) [55538] (1 species)
  7. 135854Species Human (Homo sapiens) [TaxId:9606] [55539] (3 PDB entries)
  8. 135856Domain d1mmpa_: 1mmp A: [40397]

Details for d1mmpa_

PDB Entry: 1mmp (more details), 2.3 Å

PDB Description: matrilysin complexed with carboxylate inhibitor

SCOP Domain Sequences for d1mmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmpa_ d.92.1.11 (A:) Matrilysin (MMP-9) {Human (Homo sapiens)}
yslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkeiplhfrkvvwgtadi
migfargahgdsypfdgpgntlahafapgtglggdahfdederwtdgsslginflyaath
elghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygk

SCOP Domain Coordinates for d1mmpa_:

Click to download the PDB-style file with coordinates for d1mmpa_.
(The format of our PDB-style files is described here.)

Timeline for d1mmpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mmpb_