Lineage for d1d8mb_ (1d8m B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheetSuperfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries) 
Domain d1d8mb_: 1d8m B: [40393]
complexed with bbh, ca, zn
Details for d1d8mb_
PDB Entry: 1d8m (more details), 2.44 Å
PDB Description: crystal structure of mmp3 complexed with a heterocycle-based inhibitor
PDB Compounds: (B:) stromelysin-1 precursorSCOPe Domain Sequences for d1d8mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8mb_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet
SCOPe Domain Coordinates for d1d8mb_:
Click to download the PDB-style file with coordinates for d1d8mb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d8mb_:
- d1d8mb_ first appeared (with stable ids) in SCOP 1.55
- d1d8mb_ appears in SCOPe 2.07
View in 3D
