Lineage for d1d8mb_ (1d8m B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. Domain d1d8mb_: 1d8m B: [40393]
    complexed with bbh, ca, zn

Details for d1d8mb_

PDB Entry: 1d8m (more details), 2.44 Å

PDB Description: crystal structure of mmp3 complexed with a heterocycle-based inhibitor
PDB Compounds: (B:) stromelysin-1 precursor

SCOPe Domain Sequences for d1d8mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8mb_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

SCOPe Domain Coordinates for d1d8mb_ are not available.

Timeline for d1d8mb_:

Domains from other chains:
(mouse over for more information)
d1d8ma_