PDB entry 1d8m

View 1d8m on RCSB PDB site
Description: crystal structure of mmp3 complexed with a heterocycle-based inhibitor
Class: hydrolase
Keywords: mixed alpha beta structure, zinc protease, inhibited, hydrolase
Deposited on 1999-10-25, released 2000-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.277
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stromelysin-1 precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d8ma_
  • Chain 'B':
    Compound: stromelysin-1 precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d8mb_
  • Heterogens: ZN, CA, BBH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d8mA (A:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8mA (A:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d8mB (B:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet