SCOPe 2.07: Domain d6uvda1: 6uvd A:1-197

Lineage for d6uvda1 (6uvd A:1-197)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (46 PDB entries)

8. Domain d6uvda1: 6uvd A:1-197 [403877]
   Other proteins in same PDB: d6uvda2
   automated match to d4z9vb_
   complexed with edo, so4, xou

Details for d6uvda1

PDB Entry: 6uvd, 2.15 Å

PDB Description: crystal structure of bcl-xl bound to compound 2: (2r)-3- (benzylsulfanyl)-2-({[(4-methylphenyl)methyl] [(4 phenylphenyl) carbonyl] carbamoyl}amino) propanoic acid

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d6uvda1:

Sequence; same for both SEQRES and ATOM records:

>d6uvda1 f.1.4.1 (A:1-197) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygn

Timeline for d6uvda1:

• d6uvda1 is new in SCOPe 2.07-stable
  
• d6uvda1 appears in the current release, SCOPe 2.08