SCOP 1.59: Domain d1d5jb_: 1d5j B:

Lineage for d1d5jb_ (1d5j B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries)

8. Domain d1d5jb_: 1d5j B: [40387]

Details for d1d5jb_

PDB Entry: 1d5j, 2.6 Å

PDB Description: crystal structure of mmp3 complexed with a thiazepine based inhibitor.

SCOP Domain Sequences for d1d5jb_:

Sequence; same for both SEQRES and ATOM records:

>d1d5jb_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

Timeline for d1d5jb_:

• d1d5jb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d5jb_ appears in SCOP 1.57
  
• d1d5jb_ appears in SCOP 1.61
  
• d1d5jb_ appears in the current release, SCOPe 2.08