SCOPe 2.05: Domain d1biwa_: 1biw A:

Lineage for d1biwa_ (1biw A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries)

8. Domain d1biwa_: 1biw A: [40384]
   complexed with ca, s80, zn

Details for d1biwa_

PDB Entry: 1biw, 2.5 Å

PDB Description: design and synthesis of conformationally-constrained mmp inhibitors

PDB Compounds: (A:) protein (stromelysin-1 complex)

SCOPe Domain Sequences for d1biwa_:

Sequence; same for both SEQRES and ATOM records:

>d1biwa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppd

Timeline for d1biwa_:

• d1biwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1biwa_ appears in SCOPe 2.04
  
• d1biwa_ appears in SCOPe 2.06
  
• d1biwa_ appears in the current release, SCOPe 2.08