Lineage for d1b3db_ (1b3d B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194566Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 194567Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 194701Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)
  6. 194782Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 194783Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries)
  8. 194807Domain d1b3db_: 1b3d B: [40383]

Details for d1b3db_

PDB Entry: 1b3d (more details), 2.3 Å

PDB Description: stromelysin-1

SCOP Domain Sequences for d1b3db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3db_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

SCOP Domain Coordinates for d1b3db_:

Click to download the PDB-style file with coordinates for d1b3db_.
(The format of our PDB-style files is described here.)

Timeline for d1b3db_: