Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species) |
Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries) Uniprot Q8CM25 13-352 |
Domain d7nhpd_: 7nhp D: [403717] Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_ automated match to d2axtd1 complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhp (more details), 2.72 Å
SCOPe Domain Sequences for d7nhpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhpd_ f.26.1.1 (D:) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]} rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef etfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d7nhpd_: