SCOP 1.59: Domain d1hfs__: 1hfs -

Lineage for d1hfs__ (1hfs -)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries)

8. Domain d1hfs__: 1hfs - [40370]

Details for d1hfs__

PDB Entry: 1hfs, 1.7 Å

PDB Description: crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the n-carboxy-alkyl inhibitor l-764,004

SCOP Domain Sequences for d1hfs__:

Sequence; same for both SEQRES and ATOM records:

>d1hfs__ d.92.1.11 (-) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
gipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadimisfa
vrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaaheighsl
glfhsantealmyplyhsltdltrfrlsqddingiqslyg

Timeline for d1hfs__:

• d1hfs__ first appeared (with stable ids) in SCOP 1.55
  
• d1hfs__ appears in SCOP 1.57
  
• d1hfs__ appears in SCOP 1.61
  
• d1hfs__ appears in the current release, SCOPe 2.08, called d1hfsa_