Lineage for d1umta_ (1umt A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries) 
Domain d1umta_: 1umt A: [40369]
Details for d1umta_
PDB Entry: 1umt (more details)
PDB Description: Stromelysin-1 catalytic domain with hydrophobic inhibitor bound, ph 7.0, 32oc, 20 mm cacl2, 15% acetonitrile; nmr average of 20 structures minimized with restraints
SCOP Domain Sequences for d1umta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umta_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygp
SCOP Domain Coordinates for d1umta_:
Click to download the PDB-style file with coordinates for d1umta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1umta_:
- d1umta_ first appeared (with stable ids) in SCOP 1.55
- d1umta_ appears in SCOP 1.59
- d1umta_ appears in SCOP 1.63
- d1umta_ appears in the current release, SCOPe 2.08
View in 3D