SCOPe 2.06: Domain d1umsa_: 1ums A:

Lineage for d1umsa_ (1ums A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (40 PDB entries)

8. Domain d1umsa_: 1ums A: [40368]
   complexed with ca, hae, mop, zn

Details for d1umsa_

PDB Entry: 1ums

PDB Description: stromelysin-1 catalytic domain with hydrophobic inhibitor bound, ph 7.0, 32oc, 20 mm cacl2, 15% acetonitrile; nmr ensemble of 20 structures

PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d1umsa_:

Sequence; same for both SEQRES and ATOM records:

>d1umsa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygp

Timeline for d1umsa_:

• d1umsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1umsa_ appears in SCOPe 2.05
  
• d1umsa_ appears in SCOPe 2.07
  
• d1umsa_ appears in the current release, SCOPe 2.08