Lineage for d2srt__ (2srt -)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries) 
Domain d2srt__: 2srt - [40367]
Details for d2srt__
PDB Entry: 2srt (more details)
PDB Description: catalytic domain of human stromelysin-1 at ph 5.5 and 40oc complexed with inhibitor
SCOP Domain Sequences for d2srt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2srt__ d.92.1.11 (-) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet
SCOP Domain Coordinates for d2srt__:
Click to download the PDB-style file with coordinates for d2srt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2srt__:
- d2srt__ first appeared (with stable ids) in SCOP 1.55
- d2srt__ appears in SCOP 1.59
- d2srt__ appears in SCOP 1.63
- d2srt__ appears in the current release, SCOPe 2.08, called d2srta_
View in 3D