SCOPe 2.08: Domain d6m0td1: 6m0t D:80-228

Lineage for d6m0td1 (6m0t D:80-228)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)
Family b.40.4.0: automated matches [191416] (1 protein)
not a true family
Protein automated matches [190576] (52 species)
not a true protein
Species Plasmodium falciparum [TaxId:36329] [234564] (7 PDB entries)
Domain d6m0td1: 6m0t D:80-228 [403657]
Other proteins in same PDB: d6m0ta2, d6m0tb2, d6m0tc2, d6m0td2
automated match to d3bjua1
protein/RNA complex; complexed with ez3, lys

Details for d6m0td1

PDB Entry: 6m0t (more details), 2.68 Å

PDB Description: crystal structure of lysyl-trna synthetase from plasmodium falciparum complexed with l-lysine and cladosporin derivative (cl-2)

PDB Compounds: (D:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6m0td1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m0td1 b.40.4.0 (D:80-228) automated matches {Plasmodium falciparum [TaxId: 36329]}
prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
kkgelsifpketillsaclhmlpmkyglk

SCOPe Domain Coordinates for d6m0td1:

Click to download the PDB-style file with coordinates for d6m0td1.
(The format of our PDB-style files is described here.)

Timeline for d6m0td1: