Lineage for d1bqob_ (1bqo B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194566Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 194567Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 194701Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)
  6. 194782Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 194783Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (28 PDB entries)
  8. 194805Domain d1bqob_: 1bqo B: [40364]

Details for d1bqob_

PDB Entry: 1bqo (more details), 2.3 Å

PDB Description: discovery of potent, achiral matrix metalloproteinase inhibitors

SCOP Domain Sequences for d1bqob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqob_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

SCOP Domain Coordinates for d1bqob_:

Click to download the PDB-style file with coordinates for d1bqob_.
(The format of our PDB-style files is described here.)

Timeline for d1bqob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bqoa_