Lineage for d7mc5m_ (7mc5 M:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038801Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily)
    binds two zinc ion per subunit; forms a dodecameric shell
  4. 3038802Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) (S)
    automatically mapped to Pfam PF09401
  5. 3038803Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins)
    partly covered by PfamB PB001266
  6. 3038868Protein automated matches [191249] (3 species)
    not a true protein
  7. 3038876Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382496] (25 PDB entries)
  8. 3038878Domain d7mc5m_: 7mc5 M: [403558]
    automated match to d2xyqb_
    protein/RNA complex; complexed with cl, edo, tla, zn

Details for d7mc5m_

PDB Entry: 7mc5 (more details), 1.64 Å

PDB Description: crystal structure of the sars-cov-2 exon-nsp10 complex
PDB Compounds: (M:) non-structural protein 10

SCOPe Domain Sequences for d7mc5m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mc5m_ g.86.1.1 (M:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
agnatevpanstvlsfcafavdaakaykdylasggqpitncvkmlcthtgtgqaitvtpe
anmdqesfggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlkntvctvc
gmwkgygcsc

SCOPe Domain Coordinates for d7mc5m_:

Click to download the PDB-style file with coordinates for d7mc5m_.
(The format of our PDB-style files is described here.)

Timeline for d7mc5m_: