Class g: Small proteins [56992] (100 folds) |
Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily) binds two zinc ion per subunit; forms a dodecameric shell |
Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) automatically mapped to Pfam PF09401 |
Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins) partly covered by PfamB PB001266 |
Protein automated matches [191249] (3 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382496] (25 PDB entries) |
Domain d7mc5m_: 7mc5 M: [403558] automated match to d2xyqb_ protein/RNA complex; complexed with cl, edo, tla, zn |
PDB Entry: 7mc5 (more details), 1.64 Å
SCOPe Domain Sequences for d7mc5m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7mc5m_ g.86.1.1 (M:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} agnatevpanstvlsfcafavdaakaykdylasggqpitncvkmlcthtgtgqaitvtpe anmdqesfggascclycrchidhpnpkgfcdlkgkyvqipttcandpvgftlkntvctvc gmwkgygcsc
Timeline for d7mc5m_: