Lineage for d1a86a_ (1a86 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins) 
Protein Neutrophil collagenase (MMP-8) [55532] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55533] (14 PDB entries) 
Domain d1a86a_: 1a86 A: [40354]
Details for d1a86a_
PDB Entry: 1a86 (more details), 2 Å
PDB Description: mmp8 with malonic and aspartic acid based inhibitor
SCOP Domain Sequences for d1a86a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a86a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)}
npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
lahssdpgalmypnyafretsnyslpqddidgiqaiyg
SCOP Domain Coordinates for d1a86a_:
Click to download the PDB-style file with coordinates for d1a86a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a86a_:
- d1a86a_ first appeared (with stable ids) in SCOP 1.55
- d1a86a_ appears in SCOP 1.57
- d1a86a_ appears in SCOP 1.61
- d1a86a_ appears in the current release, SCOPe 2.08
View in 3D