Lineage for d7lc4a1 (7lc4 A:57-221)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610396Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 2610397Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 2610433Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. 2610434Protein automated matches [226981] (13 species)
    not a true protein
  7. 2610452Species Pseudomonas aeruginosa [TaxId:287] [234430] (7 PDB entries)
  8. 2610455Domain d7lc4a1: 7lc4 A:57-221 [403465]
    Other proteins in same PDB: d7lc4a2
    automated match to d4weka1
    complexed with xvg

Details for d7lc4a1

PDB Entry: 7lc4 (more details), 2 Å

PDB Description: crystal structure of pseudomonas aeruginosa pbp3 in complex with gamma-lactam yu253911
PDB Compounds: (A:) Peptidoglycan D,D-transpeptidase FtsI

SCOPe Domain Sequences for d7lc4a1:

Sequence, based on SEQRES records: (download)

>d7lc4a1 d.175.1.0 (A:57-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
aipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadrieq
naerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddrgre
gielafdewlagvpgkrqvlkdrrgrvikdvqvtknakpgktlal

Sequence, based on observed residues (ATOM records): (download)

>d7lc4a1 d.175.1.0 (A:57-221) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
aipahrglitdrngeplavstpvttlwanpkelmtakerwpqlaaalgqdtklfadrieq
naerefiylvrgltpeqgegvialkvpgvysieefrrfypagevvahavgftdvddrgre
gielafdewlagvpgakpgktlal

SCOPe Domain Coordinates for d7lc4a1:

Click to download the PDB-style file with coordinates for d7lc4a1.
(The format of our PDB-style files is described here.)

Timeline for d7lc4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7lc4a2