Lineage for d7e90b_ (7e90 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856189Species Vibrio parahaemolyticus [TaxId:670] [403249] (1 PDB entry)
  8. 2856191Domain d7e90b_: 7e90 B: [403250]
    automated match to d3f6pa_

Details for d7e90b_

PDB Entry: 7e90 (more details), 2.25 Å

PDB Description: crystal structure of the receiver domain (d51e) of the response regulator vbrr from vibrio parahaemolyticus
PDB Compounds: (B:) DNA-binding response regulator

SCOPe Domain Sequences for d7e90b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7e90b_ c.23.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
kqtlllveddknladgllvsleqagyeclhveriadvepqwkkadlvilerqlpdgdsvq
hlpewkkikdvpvilltalvtvkdkvagldsgandyltkpfaeaelfariraqlr

SCOPe Domain Coordinates for d7e90b_:

Click to download the PDB-style file with coordinates for d7e90b_.
(The format of our PDB-style files is described here.)

Timeline for d7e90b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d7e90a_