SCOPe 2.08: Domain d7e90b_: 7e90 B:

Lineage for d7e90b_ (7e90 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Vibrio parahaemolyticus [TaxId:670] [403249] (1 PDB entry)

8. Domain d7e90b_: 7e90 B: [403250]
   automated match to d3f6pa_

Details for d7e90b_

PDB Entry: 7e90, 2.25 Å

PDB Description: crystal structure of the receiver domain (d51e) of the response regulator vbrr from vibrio parahaemolyticus

PDB Compounds: (B:) DNA-binding response regulator

SCOPe Domain Sequences for d7e90b_:

Sequence; same for both SEQRES and ATOM records:

>d7e90b_ c.23.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
kqtlllveddknladgllvsleqagyeclhveriadvepqwkkadlvilerqlpdgdsvq
hlpewkkikdvpvilltalvtvkdkvagldsgandyltkpfaeaelfariraqlr

Timeline for d7e90b_:

• d7e90b_ first appeared in SCOPe 2.07