Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Vibrio parahaemolyticus [TaxId:670] [403249] (1 PDB entry) |
Domain d7e90b_: 7e90 B: [403250] automated match to d3f6pa_ |
PDB Entry: 7e90 (more details), 2.25 Å
SCOPe Domain Sequences for d7e90b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7e90b_ c.23.1.0 (B:) automated matches {Vibrio parahaemolyticus [TaxId: 670]} kqtlllveddknladgllvsleqagyeclhveriadvepqwkkadlvilerqlpdgdsvq hlpewkkikdvpvilltalvtvkdkvagldsgandyltkpfaeaelfariraqlr
Timeline for d7e90b_: