SCOPe 2.07: Domain d7cxtb1: 7cxt B:1-345

Lineage for d7cxtb1 (7cxt B:1-345)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [225997] (7 PDB entries)

8. Domain d7cxtb1: 7cxt B:1-345 [403181]
   Other proteins in same PDB: d7cxta2, d7cxta3, d7cxtb2, d7cxtb3
   automated match to d3enka_
   complexed with ndp

Details for d7cxtb1

PDB Entry: 7cxt, 2.05 Å

PDB Description: crystal structure of a gdp-6-ome-4-keto-l-xylo-heptose reductase from c.jejuni

PDB Compounds: (B:) GDP-l-fucose synthase

SCOPe Domain Sequences for d7cxtb1:

Sequence; same for both SEQRES and ATOM records:

>d7cxtb1 c.2.1.0 (B:1-345) automated matches {Campylobacter jejuni [TaxId: 192222]}
mqtnskiyiaghkgtagtalvenlqkrgfnnlvlktrqeldlvnqqavakffkeekpeyv
fltavlpcgaanvaqradfiyenlmiqnnvihnsflnnvkklvffgsgymypenaknplk
eeylfqgdleygaysfgaakiagaimcesyniqygtnfitlvlnnlygtkanfdfgksrv
lpallrkfhlakllsegnitqilqdlkmnnfeeakeylhnfgiskksveiwgtgkvrref
ihsddladvaiytmqnidfkdlikdrksknthinigtgidysikevalmvknivgfsgel
vfntsrpdstmdrlmdcskihslgwkhkielkdgikmmyewyktq

Timeline for d7cxtb1:

• d7cxtb1 is new in SCOPe 2.07-stable
  
• d7cxtb1 appears in the current release, SCOPe 2.08