Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) automatically mapped to Pfam PF01788 |
Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
Protein automated matches [191002] (3 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (24 PDB entries) |
Domain d7couj_: 7cou j: [403137] Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couf_, d7couh_, d7coui_, d7couk_, d7coul_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_ automated match to d5ws5j_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cou (more details), 2.25 Å
SCOPe Domain Sequences for d7couj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7couj_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} mseggriplwivatvagmgvivivglffygayaglgssl
Timeline for d7couj_: