Lineage for d7bhva1 (7bhv A:16-125)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583085Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)
  8. 2583101Domain d7bhva1: 7bhv A:16-125 [402982]
    automated match to d2hj2a1
    complexed with sam, tqb

Details for d7bhva1

PDB Entry: 7bhv (more details), 1.16 Å

PDB Description: crystal structure of mat2a bound to allosteric inhibitor and in vivo tool compound 28
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d7bhva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bhva1 d.130.1.0 (A:16-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsra
avdyqkvvreavkhigyddsskgfdyktcnvlvaleqqspdiaqgvhldr

SCOPe Domain Coordinates for d7bhva1:

Click to download the PDB-style file with coordinates for d7bhva1.
(The format of our PDB-style files is described here.)

Timeline for d7bhva1: