Lineage for d6y4na2 (6y4n A:246-439)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959756Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)
  8. 2959820Domain d6y4na2: 6y4n A:246-439 [402812]
    Other proteins in same PDB: d6y4na1, d6y4nb1, d6y4nb2, d6y4nc1, d6y4nd1, d6y4nd2, d6y4ne_, d6y4nf1, d6y4nf2, d6y4nf3
    automated match to d4i50a2
    complexed with acp, ca, gdp, gtp, mes, mg, o9b, o9k, o9n, p6s, peg, pge, val

Details for d6y4na2

PDB Entry: 6y4n (more details), 2.85 Å

PDB Description: structure of tubulin tyrosine ligase in complex with tb116
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6y4na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y4na2 d.79.2.1 (A:246-439) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d6y4na2:

Click to download the PDB-style file with coordinates for d6y4na2.
(The format of our PDB-style files is described here.)

Timeline for d6y4na2: