SCOPe 2.08: Domain d6y7sb_: 6y7s B:

Lineage for d6y7sb_ (6y7s B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [346217] (8 PDB entries)

8. Domain d6y7sb_: 6y7s B: [402765]
   automated match to d2m5ga_

Details for d6y7sb_

PDB Entry: 6y7s, 2.8 Å

PDB Description: 2.85 a cryo-em structure of the in vivo assembled type 1 pilus rod

PDB Compounds: (B:) FimA

SCOPe Domain Sequences for d6y7sb_:

Sequence; same for both SEQRES and ATOM records:

>d6y7sb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 83333]}
aattvnggtvhfkgevvnaacavdagsvdqtvqlgqvrtaslaqegatssavgfniqlnd
cdtnvaskaavaflgtaidaghtnvlalqssaagsatnvgvqildrtgaaltldgatfss
ettlnngtntipfqaryfatgaatpgaanadatfkvqyq

Timeline for d6y7sb_:

• d6y7sb_ first appeared in SCOPe 2.07